PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015874024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 680aa    MW: 77504.4 Da    PI: 6.5137
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015874024.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS373.42.9e-1143106783374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lL +cA+av++ d++ a+++L+++++++sp+gd +qRla+yf+++L+ rl++ +s ly +  ++ ts    ++ l+a++++  ++P+ ++s++ 
  XP_015874024.1 310 TLLNHCAQAVANYDQKTANQVLQQIKQHSSPYGDGTQRLAHYFANGLEVRLVG-GSPLYMTYVSNGTS---AADILKAYHAYITACPFKRMSNIF 400
                     689*************************************************9.99999988888887...99********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN++I + +++++r+HiiDf+i +G QWp+L+q L+ R++gpp+lR+Tg++ p++g   +e++eetg+rLa+++++++vpfe++v +ak++e+++
  XP_015874024.1 401 ANRTIAKLAAKARRLHIIDFGILYGYQWPCLIQGLSVRSGGPPMLRVTGIEFPQPGfrPSERVEETGRRLANYCKRFNVPFEYHV-IAKKWETIR 494
                     *******************************************************9****************************9.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     +e+L+++++E +aVn+++++ +++de+v  +s+rd+vLkl+k+++P+++++   +  +n++ Fl+rf eal+++salfd++ea+l++e+++r   
  XP_015874024.1 495 YEDLKIDRDEFIAVNCIYRMRHIPDETVLEDSPRDTVLKLIKRINPDIFIHGVVNGTYNTPFFLTRFREALYHFSALFDMFEASLSTEDQDRLRF 589
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     E+e++g++++n++aceg +r+er et+++W+ r  +aG+k+vpl+ +++k++k ++r  + + + v+e+  ++++gWk+r + ++S+W+
  XP_015874024.1 590 EKEVFGKNVMNAIACEGLQRVERPETYKQWQVRNVRAGLKQVPLDREIVKKVKNMVRSEYHKDFVVDEDGMWMLQGWKGRIIKAISCWK 678
                     ***********************************************************9888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.745282658IPR005202Transcription factor GRAS
PfamPF035141.0E-111310678IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    Send to blast
MDTLLEGLPG SVNRFRFDHD STLGYSNRNL AHEFKVEHEF NGSHFPPDDL EIPCDSSSSP  60
SSGSSSSDAD YPENSQDFST AVLKYINEML MEEEDLEVKP CMLQDCLALQ AAEKSLYEVI  120
GQNYPSSFNQ SLSVCSSKRV DSEGGFDQHE FESSFIQNSL TDSPPVDSLL VSDSFSETNY  180
VDHFNEGIKE ARKFLPNRKV EIIDLESSTP LKVDERYKSK SISKGKKNHH REDGDADQQG  240
RSNKHSAVSP DSYEPQEMFD KVLLCQNGHP ELESCADDND KIGEKGKLLT KGSSGKKSRQ  300
KKLEVVDLWT LLNHCAQAVA NYDQKTANQV LQQIKQHSSP YGDGTQRLAH YFANGLEVRL  360
VGGSPLYMTY VSNGTSAADI LKAYHAYITA CPFKRMSNIF ANRTIAKLAA KARRLHIIDF  420
GILYGYQWPC LIQGLSVRSG GPPMLRVTGI EFPQPGFRPS ERVEETGRRL ANYCKRFNVP  480
FEYHVIAKKW ETIRYEDLKI DRDEFIAVNC IYRMRHIPDE TVLEDSPRDT VLKLIKRINP  540
DIFIHGVVNG TYNTPFFLTR FREALYHFSA LFDMFEASLS TEDQDRLRFE KEVFGKNVMN  600
AIACEGLQRV ERPETYKQWQ VRNVRAGLKQ VPLDREIVKK VKNMVRSEYH KDFVVDEDGM  660
WMLQGWKGRI IKAISCWKAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-453126788375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874024.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5W3910.0M5W391_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14